PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G160300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 305aa    MW: 33495 Da    PI: 5.8665
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G160300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.68.1e-151461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++lv  +   G  +W+++++  g+ R++k+c++rw +yl
  Sevir.6G160300.1.p 14 KGPWTAEEDQKLVSFILGNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                        79******************************99************97 PP

2Myb_DNA-binding51.81.9e-1671111547
                         -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +  E++l +d+++qlG++ W++Ia+ ++ gRt++++k++w+++
  Sevir.6G160300.1.p  71 SDAEEKLVIDLHAQLGNR-WSKIASQLP-GRTDNEIKNHWNTH 111
                         778***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-19562IPR009057Homeodomain-like
PROSITE profilePS5129414.15961IPR017930Myb domain
SuperFamilySSF466898.99E-2611108IPR009057Homeodomain-like
SMARTSM007174.7E-111363IPR001005SANT/Myb domain
PfamPF002492.6E-131461IPR001005SANT/Myb domain
CDDcd001678.83E-91661No hitNo description
PROSITE profilePS5129426.33462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2463117IPR009057Homeodomain-like
SMARTSM007171.3E-1466114IPR001005SANT/Myb domain
CDDcd001673.54E-1271112No hitNo description
PfamPF002493.9E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVSFIL GNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDAEEKLVID LHAQLGNRWS KIASQLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPLTHKPLS PPQEHQQSPP PAVGSSEAQP PSPPPERNPP EEKAATGSSS EHGDDELILR  180
KSPGFCTDEV PMMHPDEIMV PLGDQPPPPL PALTCAPTAA AAVSTPTTSY STSGSSSCLT  240
RDVESPFAFM DMGLPEFVFQ TTGLEDDMVD DARWHDLLLP PSPAYEDPFD SYQFQRNGAL  300
FSSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0362291e-169BT036229.1 Zea mays full-length cDNA clone ZM_BFb0101M11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973482.10.0PREDICTED: myb-related protein 315
SwissprotQ50EX65e-86ODO1_PETHY; Protein ODORANT1
TrEMBLK3YIS50.0K3YIS5_SETIT; Uncharacterized protein
STRINGSi014144m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.15e-86myb domain protein 20